CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Khandvi Rolls

Silky gram-flour spirals, steamed in minutes, then pan-fried until edges crisp. Finished with mustard tempering and fresh cilantro—pure umami comfort.

Total time
18 min
Servings
2
Calories
185
Protein
6g
Crispy Khandvi Rolls
comfortsimpleindianvegetarianveganchickpeassilkycrispy

Ingredients

  • 1 cup gram flour (besan)
  • 1.5 cups water
  • ¼ tsp turmeric powder
  • 1 whole green chili, minced
  • ½ tbsp ginger, grated
  • ½ tsp mustard seeds

Instructions

  1. 1

    Whisk gram flour, water, turmeric, chili, and ginger in a bowl until smooth and lump-free.

  2. 2

    Pour batter into a large nonstick skillet over medium heat, stirring constantly until it thickens and pulls from the sides, ~6 minutes.

  3. 3

    Spread the thick batter onto a parchment-lined plate or board while still warm; let cool 2 minutes.

  4. 4

    Cut the sheet into strips, then roll each loosely and arrange seam-side down in the same skillet.

  5. 5

    Sear rolls over medium-high heat until edges are golden and crisp, ~3 minutes; flip and sear the other side.

  6. 6

    Push rolls aside, add oil and mustard seeds to the pan, let seeds pop, then drizzle over rolls and serve.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • large nonstick skillet, 12-inch
  • wooden spoon
  • parchment paper
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.