10-Min Crispy Dolmades with Lemon
Jarred dolmades crisped in a skillet until edges curl, finished with a bright lemon-butter drizzle. Ready in under 10 minutes—no stuffing required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 7g

freshsimplegreekmediterraneanvegetarianvegetariancrispytender
Ingredients
- 1 jar (about 16 oz) jarred dolmades (grape leaves stuffed with rice)
- 2 tbsp butter
- 1 whole (juiced) lemon
- 1 whole garlic clove, minced
- 1 tbsp fresh dill or oregano, chopped
- ¼ tsp each salt and pepper
Instructions
- 1
Drain dolmames and pat dry with paper towels.
- 2
Heat butter in a skillet over medium-high heat until foaming, about 60 seconds.
- 3
Add dolmames and cook without stirring until edges brown and crisp, 3-4 minutes.
- 4
Add minced garlic and cook 30 seconds until fragrant, then squeeze in lemon juice.
- 5
Toss to coat. Season with salt, pepper, and fresh dill.
- 6
Serve hot, drizzling any pan sauce over the top.
Tools you’ll need
- 12-inch skillet or sauté pan
- paper towels
- colander or strainer
- wooden spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
More recipes like this
Craving more? Browse all Greek recipes →



