CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Crispy Chili Garlic Pancit

Stir-fried Filipino noodles loaded with vegetables, tossed in a garlicky chili-soy glaze, and finished with crispy edges. One skillet, weeknight-easy, and totally addictive.

Total time
15 min
Servings
4
Calories
285
Protein
8g
15-Min Crispy Chili Garlic Pancit
comfortquickfilipinovegetarianvegetariancrispychewyweeknight

Ingredients

  • 1 package (10 oz) fresh pancit canton noodles or dried ramen
  • 3 cups cabbage, thinly sliced
  • 1 medium carrot, julienned or grated
  • 4 cloves garlic, minced
  • 2 tbsp chili crisp or hot pepper flakes
  • 3 tbsp soy sauce
  • 2 tbsp neutral cooking oil

Instructions

  1. 1

    Cook noodles in boiling salted water until al dente, about 3 minutes. Drain and set aside.

  2. 2

    Heat oil in a large skillet over medium-high until shimmering. Add garlic, stir for 30 seconds until fragrant.

  3. 3

    Add cabbage and carrot, toss constantly for 3 minutes until edges start to char and soften.

  4. 4

    Pour in soy sauce and chili crisp, toss to coat evenly. Cook for 1 minute until glaze coats the vegetables.

  5. 5

    Add cooked noodles to the skillet, toss constantly for 2 minutes until noodles crisp at the edges and everything is hot.

  6. 6

    Serve immediately in bowls or on a plate while the noodles still have crispy bits.

Tools you’ll need

  • large skillet (12-inch preferred)
  • pot for boiling water
  • tongs or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Filipino recipes →