CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Chicken Parm

Pounded thin chicken cutlets, breaded and pan-fried until golden, then smothered in marinara and melted mozzarella. Ready in 15 minutes and tastes like you spent way longer.

Total time
15 min
Servings
2
Calories
520
Protein
48g
Crispy Chicken Parm
comfortquickamericanchickencrispytendermeltyweeknight

Ingredients

  • 2 breasts (about 6 oz each) boneless, skinless chicken breasts
  • ½ cup all-purpose flour
  • 1 large egg
  • ¾ cup panko breadcrumbs
  • 1 cup (store-bought) marinara sauce
  • 1 cup mozzarella, shredded

Instructions

  1. 1

    Place each chicken breast between plastic wrap and pound to 1/4-inch thick using a meat mallet or heavy pan.

  2. 2

    Set up three shallow bowls with flour, beaten egg, and panko mixed with a pinch of salt and pepper.

  3. 3

    Coat each chicken breast in flour, shaking off excess, then dip in egg, then press into panko until fully coated.

  4. 4

    Heat olive oil in a 12-inch skillet over medium-high heat. Once shimmering, slide in the breaded chicken.

  5. 5

    Fry 3 minutes per side until golden brown and cooked through. Transfer to a plate.

  6. 6

    Return chicken to the skillet, pour marinara over each piece, scatter mozzarella on top, cover, and cook until cheese melts, about 2 minutes.

Tools you’ll need

  • meat mallet or heavy pan
  • three shallow bowls
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.