Custrd is out on the App Store — Download it free →
Back to recipes

Cheese Dakgalbi

Spicy stir-fried chicken with sweet rice cakes, melted cheese, and gochujang sauce. A Korean comfort dish that's crispy, cheesy, and deeply satisfying in one pan.

Total time
40 min
Servings
4
Calories
520
Protein
38g
Cheese Dakgalbi
comfortindulgentkoreanchickencrispytendermeltychewy

Ingredients

  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp honey
  • 2 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 3 cloves garlic, minced
  • 1.25 lbs chicken thighs, boneless and skinless, cut into 1-inch pieces
  • 1 cup Korean rice cakes (tteokbokki), fresh or frozen
  • 1 cup mozzarella cheese, cubed or torn
  • 3 stalks scallions, cut into 1-inch pieces
  • 2 tbsp vegetable oil
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Whisk gochujang, honey, soy sauce, vinegar, and garlic in a bowl until smooth and no lumps remain.

  2. 2

    Pat chicken dry with paper towels and season generously with salt and pepper.

  3. 3

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 60 seconds.

  4. 4

    Add chicken and cook, stirring frequently, until browned on all sides and no pink remains, 8–10 minutes.

  5. 5

    Pour sauce into the skillet and stir to coat all chicken pieces evenly.

  6. 6

    Add rice cakes and stir gently until coated in sauce and warmed through, 3–4 minutes.

  7. 7

    Scatter cheese cubes over the top and cook without stirring until cheese begins to melt, 2–3 minutes.

  8. 8

    Stir gently to combine melted cheese with chicken and rice cakes.

  9. 9

    Garnish with scallions and serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet or large wok
  • mixing bowl
  • whisk
  • paper towels
  • wooden spoon or silicone spatula
  • chef's knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.