CookSnap is coming soon — Join the waitlist →

Crispy Cheese Ball with Tomato & Salad

A Swiss-inspired fried cheese ball (malakoff) served with warm tomato sauce and a tangy shredded vegetable salad. Golden, melty, and addictive — ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
720
Protein
28g
Crispy Cheese Ball with Tomato & Salad
comfortindulgentswissvegetariancheesecrispymeltyweeknight

Ingredients

  • 1.5 cups gruyère cheese, coarsely grated
  • 1.5 cups emmental cheese, coarsely grated
  • ¾ cup all-purpose flour, divided
  • 2 cups neutral oil for frying
  • 1 cup marinara or tomato sauce
  • 1.5 cups shredded vegetable salad (carrots, beets, celery root)

Instructions

  1. 1

    Toss both cheeses with half the flour (about 6 tbsp) and a pinch of salt until the mixture is crumbly and evenly coated.

  2. 2

    Divide into 2 balls and coat each in the remaining flour, pressing gently so the flour adheres.

  3. 3

    Heat oil in a heavy pot to 350°F (a piece of bread browns in 60 seconds). Carefully slide the cheese balls into the oil.

  4. 4

    Fry for 4–5 minutes, turning once with a slotted spoon, until golden brown and crispy on all sides.

  5. 5

    Drain on paper towels. Warm the tomato sauce in a small pan over medium heat until steaming, about 2 minutes.

  6. 6

    Plate the warm cheese ball, spoon tomato sauce alongside, and serve with the shredded vegetable salad on the side.

Tools you’ll need

  • heavy-bottomed pot or deep skillet
  • instant-read thermometer
  • slotted spoon
  • paper towels
  • small saucepan
  • grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.