CookSnap is coming soon — Join the waitlist →

Crispy Mozzarella Rice Balls with Side Salad

Golden-fried arancini-style rice balls with a molten mozzarella center—ready in 25 minutes. Serve alongside a fresh salad for a complete, satisfying dinner.

Total time
25 min
Servings
2
Calories
480
Protein
12g
Crispy Mozzarella Rice Balls with Side Salad
comfortindulgentitalianvegetariancheesecrispycreamyweeknight

Ingredients

  • 2 cups cooked risotto or white rice, cooled
  • 4 oz fresh mozzarella, cut into 0.5-inch cubes
  • 1 whole egg
  • ½ cup all-purpose flour
  • ¾ cup panko breadcrumbs
  • 3 cups neutral oil for frying
  • 3 cups mixed salad greens

Instructions

  1. 1

    Place flour in one shallow bowl, beaten egg in a second, and panko in a third.

  2. 2

    Scoop 2-tbsp portions of cold rice into your palm. Press a mozzarella cube into the center, then seal with rice around it.

  3. 3

    Coat each ball in flour, then egg, then panko. Press gently so breadcrumbs stick.

  4. 4

    Heat oil in a deep skillet or small pot to 350°F. Working in batches, fry balls 2–3 minutes until golden brown and crispy all over.

  5. 5

    Transfer to paper towels. Drain and season immediately with salt and pepper.

  6. 6

    Toss salad greens with a pinch of salt, pepper, and a light drizzle of olive oil. Serve alongside the warm rice balls.

Tools you’ll need

  • three shallow bowls
  • deep skillet or small pot
  • deep-fry or instant-read thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.