Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Apple Strudel Sheet Pan

Buttery phyllo layers with cinnamon-sugar apples, baked until golden and served warm with a crack of ice cream. Austrian comfort in 25 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Crispy Apple Strudel Sheet Pan
cozycomfortaustrianvegetariancrispyflakytenderweeknight

Ingredients

  • 8 sheets phyllo dough
  • 4 tbsp butter, melted
  • 4 medium apples (Granny Smith or Honeycrisp)
  • 3 tbsp granulated sugar
  • 1 tsp ground cinnamon
  • 1 tbsp fresh lemon juice
  • ¼ cup raisins or dried currants
  • 2 tbsp panko breadcrumbs

Instructions

  1. 1

    Preheat oven to 400°F. Peel and slice apples 1/4-inch thick, discarding cores.

  2. 2

    Toss apple slices with sugar, cinnamon, lemon juice, and raisins in a bowl.

  3. 3

    Brush a sheet pan with melted butter. Lay 4 phyllo sheets on the pan, brushing each with butter and a light sprinkle of breadcrumbs.

  4. 4

    Spread apple mixture evenly over phyllo. Top with remaining 4 phyllo sheets, brushing each with butter.

  5. 5

    Bake 18–20 minutes until phyllo is golden brown and edges crackle.

  6. 6

    Cool 2 minutes. Slice into squares. Serve warm.

Tools you’ll need

  • sheet pan (9x13 inch)
  • vegetable peeler
  • sharp knife
  • medium bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.