CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Vodka Pasta

Silky tomato-cream sauce spiked with vodka, finished with fresh basil. Ready in 20 minutes — the TikTok version of rigatoni alla vodka that actually gets made on a Tuesday night.

Total time
20 min
Servings
4
Calories
742
Protein
28g
Creamy Vodka Pasta
comfortelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 lb rigatoni
  • 28 oz canned crushed tomatoes
  • ½ cup vodka
  • ½ cup heavy cream
  • ¾ cup parmesan cheese, grated
  • ¼ cup fresh basil (or parsley), chopped

Instructions

  1. 1

    Boil rigatoni in salted water until al dente, ~12 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    Heat olive oil in a large skillet over medium. Add crushed tomatoes and vodka, stir once.

  3. 3

    Simmer 5 minutes until vodka smell mellows and sauce reduces slightly, stirring once halfway.

  4. 4

    Stir in cream and 0.5 cup pasta water. Simmer 2 minutes until sauce coats a spoon.

  5. 5

    Add cooked pasta and parmesan, toss until coated. Add more pasta water if sauce feels thick.

  6. 6

    Finish with fresh basil. Season with salt and pepper. Serve hot.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • measuring cups
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.