CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Tomato Spinach Pasta

A silky one-pot pasta where garlic-infused cream mingles with tomatoes and fresh spinach. Ready in under 20 minutes, no draining required.

Total time
18 min
Servings
2
Calories
485
Protein
13g
Creamy Tomato Spinach Pasta
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz pasta
  • 2 cloves, minced garlic
  • 1 can (14.5 oz) diced tomatoes (canned)
  • ½ cup heavy cream
  • 3 cups, packed spinach, fresh

Instructions

  1. 1

    Heat olive oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  2. 2

    Add minced garlic and cook, stirring, for 30 seconds until fragrant.

  3. 3

    Pour in the diced tomatoes and 1.5 cups water, then add pasta and a pinch of salt.

  4. 4

    Bring to a boil, then simmer for 10 minutes, stirring occasionally, until pasta is almost tender.

  5. 5

    Stir in heavy cream and spinach, cooking for 2 minutes until spinach wilts and sauce thickens.

  6. 6

    Taste and adjust salt and pepper, then serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.