CookSnap is coming soon — Join the waitlist →

Creamy Green Tallarines

Peruvian-style spinach pasta with a vibrant herb-and-cheese sauce, ready in under 20 minutes. Bright, herbaceous, and deeply satisfying.

Total time
18 min
Servings
2
Calories
520
Protein
18g
Creamy Green Tallarines
freshsimpleperuvianvegetariancheesecreamytenderweeknight

Ingredients

  • 2 cups spinach, fresh or frozen
  • 8 oz tallarines or fettuccine pasta
  • ½ cup queso fresco or feta cheese
  • ½ cup evaporated milk or heavy cream
  • ½ cup fresh basil, parsley, or cilantro
  • 2 cloves garlic cloves

Instructions

  1. 1

    Boil salted water in a large skillet or pot. Add pasta and cook until al dente, ~10 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    In the same skillet, heat 2 tbsp olive oil over medium. Add minced garlic and cook 30 seconds until fragrant.

  3. 3

    Add spinach and fresh herbs. Stir until spinach wilts, about 1 minute. Add evaporated milk and stir to combine.

  4. 4

    Return cooked pasta to the skillet. Crumble queso fresco over the top and toss gently, adding pasta water 1/4 cup at a time until sauce coats noodles.

  5. 5

    Season with salt and pepper to taste. Serve immediately while hot and creamy.

Tools you’ll need

  • large skillet or 3-quart pot
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.