Custrd is out on the App Store — Download it free →
Back to recipes

Creamy Chicken Suprême with Roasted Vegetables

Pan-seared chicken breast in a silky cream sauce, plated with roasted potatoes, broccoli, and carrots. French elegance in 25 minutes.

Total time
25 min
Servings
2
Calories
725
Protein
48g
Creamy Chicken Suprême with Roasted Vegetables
elegantindulgentfrenchchickentendercreamycrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry and season both sides generously with salt and pepper.

  2. Step 2

    Toss potatoes and carrots with olive oil, salt, and pepper on a sheet pan.

  3. Step 3

    Roast potatoes and carrots at 425°F for 15 minutes while you sear the chicken.

  4. Step 4

    Heat 1 tbsp butter in a large skillet over medium-high until foaming and sizzling.

  5. Step 5

    Sear chicken 5–6 minutes per side without moving until golden and internal temperature reaches 165°F. Transfer to a plate.

  6. Step 6

    Add minced shallot to the same skillet and sauté 60 seconds until fragrant.

  7. Step 7

    Pour white wine into the pan, scraping up any browned bits, then simmer for 2 minutes.

  8. Step 8

    Stir in cream and mustard, then slide chicken back into the sauce and lower heat to medium.

  9. Step 9

    Simmer gently for 3 minutes until sauce coats the back of a spoon and chicken is heated through.

  10. Step 10

    Steam broccoli in a microwave-safe bowl with 2 tbsp water for 3 minutes until tender-crisp.

  11. Step 11

    Plate chicken, sauce, roasted vegetables, and steamed broccoli. Finish with a pinch of fleur de sel.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • microwave-safe bowl
  • tongs
  • meat thermometer
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.