Custrd is out on the App Store — Download it free →
Back to recipes

20-Minute Creamy Chicken Vol-au-Vents

Buttery puff pastry cups filled with tender chicken in a silky cream sauce—restaurant-fancy but ready in minutes. Swap rotisserie chicken for homemade to cut cooking time in half.

Total time
20 min
Servings
2
Calories
520
Protein
28g
20-Minute Creamy Chicken Vol-au-Vents
elegantindulgentfrenchchickencreamytenderflakyweeknight

Ingredients

  • 4 shells frozen puff pastry vol-au-vent shells
  • 8 oz rotisserie chicken, shredded
  • ¾ cup heavy cream
  • ¼ cup chicken broth
  • 1.5 tbsp butter
  • 1 tbsp fresh tarragon or thyme, chopped

Instructions

  1. 1

    Bake vol-au-vents according to package directions (usually 15–18 min at 400°F).

  2. 2

    Heat butter in a medium skillet over medium heat until foaming, ~1 minute.

  3. 3

    Add shredded chicken, cream, and broth. Stir gently until simmering, ~2 minutes.

  4. 4

    Fold in tarragon and season with salt and pepper to taste. Cook 1 more minute.

  5. 5

    Remove vol-au-vents from oven. Spoon cream chicken into each shell and serve hot.

Tools you’ll need

  • baking sheet
  • medium skillet
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.