Custrd is out on the App Store — Download it free →
Back to recipes

Creamy Mustard Chicken with Crispy Fries

Pan-seared chicken thighs in a silky Dijon mustard cream sauce, served alongside crispy fries and a bright side salad. Classic French bistro dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
640
Protein
42g
Creamy Mustard Chicken with Crispy Fries
comfortelegantfrenchchickencrispytendercreamyweeknight

Ingredients

  • 4 pieces (about 1.5 lbs) chicken thighs, boneless and skin-on
  • 3 tbsp Dijon mustard
  • ¾ cup heavy cream
  • ½ cup dry white wine
  • 1 medium shallot, minced
  • 3 sprigs fresh thyme sprigs
  • 12 oz frozen french fries

Instructions

  1. 1

    Start the fries in the oven or air fryer per package directions so they'll be ready when the chicken finishes.

  2. 2

    Pat the chicken dry and season with salt and pepper on both sides.

  3. 3

    Heat oil in a large skillet over medium-high until it shimmers. Sear chicken skin-side down without moving for 6 minutes until golden.

  4. 4

    Flip chicken and sear the other side for 4 minutes. Transfer to a plate.

  5. 5

    Add shallot to the same skillet and cook for 1 minute until fragrant, then pour in white wine and scrape up browned bits.

  6. 6

    Whisk in mustard and cream, add thyme, and return chicken to the skillet. Simmer gently for 8 minutes until chicken is cooked through.

  7. 7

    Serve chicken and sauce with crispy fries and a crisp green salad on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • whisk
  • plate
  • oven or air fryer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.