Custrd is out on the App Store — Download it free →
Back to recipes

Avocado Toast with Halloumi

Crispy golden halloumi atop creamy smashed avocado on toasted bread, finished with fresh herbs and a squeeze of lemon. A quick, satisfying meal that's perfect for breakfast, lunch, or a light dinner.

Total time
15 min
Servings
2
Calories
420
Protein
18g
Avocado Toast with Halloumi
comfortingquickmediterraneanvegetariancheesecrispycreamyweeknight

Ingredients

  • 2 slice bread slices
  • 4 oz halloumi cheese
  • 1 avocado
  • 1 tbsp lemon juice
  • 1 tbsp olive oil
  • 2 tbsp fresh herbs (such as parsley or mint)
  • ¼ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Toast the 2 bread slices until golden and crisp, about 3-4 minutes.

  2. 2

    Cut the 4 oz halloumi into 1/2-inch thick slices. Heat 1 tbsp olive oil in a skillet over medium-high heat.

  3. 3

    Cook the halloumi slices for 2-3 minutes per side, until golden brown and crispy on the outside.

  4. 4

    While the halloumi cooks, halve and pit the avocado. Scoop the flesh into a bowl and mash with a fork.

  5. 5

    Stir the 1 tbsp lemon juice, 1/4 tsp salt, and 1/4 tsp black pepper into the mashed avocado.

  6. 6

    Spread the avocado mixture evenly over the toasted bread slices.

  7. 7

    Top with the cooked halloumi slices and sprinkle with 2 tbsp chopped fresh herbs. Serve immediately.

Tools you’ll need

  • toaster or oven
  • skillet
  • fork
  • bowl
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.