CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Garlic Chicken with Roasted Potatoes & Tomatoes

Pan-seared chicken breasts in a silky white wine and mustard sauce, served alongside crispy roasted potatoes and tomatoes. Restaurant-quality French comfort food ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
485
Protein
42g
Creamy Garlic Chicken with Roasted Potatoes & Tomatoes
elegantcomfortfrenchchickentendercrispycreamyweeknight

Ingredients

  • 2 breasts (6-8 oz each) boneless, skinless chicken breasts
  • 8 oz baby potatoes
  • 8 oz cherry tomatoes
  • ¾ cup dry white wine or chicken broth
  • 1 tbsp Dijon mustard
  • ¼ cup heavy cream or crème fraîche
  • 1 tsp, chopped (or 0.5 tsp dried) fresh thyme or tarragon

Instructions

  1. 1

    Heat oven to 425°F. Toss potatoes and tomatoes with 1 tbsp olive oil, salt, and pepper, then spread on a sheet pan.

  2. 2

    Roast vegetables for 18–20 minutes until potatoes are golden and tomatoes blister.

  3. 3

    While vegetables roast, pat chicken breasts dry and season both sides with salt and pepper.

  4. 4

    Heat 1 tbsp olive oil in a large skillet over medium-high until shimmering. Sear chicken 5 minutes per side without moving until golden.

  5. 5

    Pour wine into the skillet, add mustard and thyme, then simmer 4 minutes until sauce reduces slightly.

  6. 6

    Stir in cream, cook 1 minute until silky, then taste and season. Serve chicken alongside roasted vegetables.

Tools you’ll need

  • sheet pan
  • large skillet (12-inch)
  • wooden spoon
  • meat thermometer (optional but helpful)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all French recipes →