CookSnap is coming soon — Join the waitlist →

Crawfish Monica

Cajun-spiced crawfish and pasta in a rich, buttery cream sauce with onions and garlic. A New Orleans classic that's elegant enough for company but simple enough for a weeknight dinner.

Total time
35 min
Servings
4
Calories
720
Protein
38g
Crawfish Monica
comfortelegantcajuncrawfishcreamytenderweeknightdate-night

Ingredients

  • 1 lb fettuccine or penne pasta
  • 1.5 lb crawfish tails, peeled
  • 4 tbsp butter
  • 1 medium onion, diced
  • 3 cloves garlic, minced
  • 1 cup heavy cream
  • 2 tsp cajun seasoning

Instructions

  1. 1

    Boil salted water in a large pot. Add pasta and cook until al dente, ~8 minutes. Drain and set aside.

  2. 2

    Pat crawfish dry with paper towels. This prevents splattering.

  3. 3

    Melt butter in a 12-inch skillet over medium-high heat until foaming, ~1 minute.

  4. 4

    Add diced onion. Sauté until softened and edges begin to brown, ~4 minutes.

  5. 5

    Stir in garlic and cajun seasoning. Cook until fragrant, ~30 seconds.

  6. 6

    Add crawfish tails. Cook, stirring occasionally, until opaque, ~4 minutes.

  7. 7

    Pour in cream. Stir to combine and simmer until sauce thickens slightly, ~2 minutes.

  8. 8

    Add cooked pasta to the skillet. Toss until coated and heated through, ~1 minute.

  9. 9

    Taste and adjust seasoning with salt and pepper.

  10. 10

    Divide among four bowls and serve hot.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • colander
  • wooden spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.