CookSnap is coming soon — Join the waitlist →
Back to recipes

Creamy Mushroom Mafaldine

Tender mafaldine ribbons tossed with silky mushroom cream and fresh thyme—restaurant-quality in 25 minutes. Garlic, butter, and a splash of white wine build deep umami without meat.

Total time
25 min
Servings
2
Calories
728
Protein
24g
Creamy Mushroom Mafaldine
comfortelegantitalianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 8 oz mafaldine pasta
  • 12 oz mushrooms (cremini or mixed), sliced
  • 2 medium shallots, minced
  • 2 clove garlic, minced
  • ½ cup dry white wine
  • ¾ cup heavy cream
  • 3 sprigs fresh thyme
  • ½ cup parmesan cheese, grated

Instructions

  1. 1

    Boil mafaldine in salted water until al dente, about 11 minutes. Reserve 1 cup pasta water before draining.

  2. 2

    While pasta cooks, heat 2 tbsp butter in a large skillet over medium-high until foaming.

  3. 3

    Add mushroom slices; sauté until golden and liquid releases, about 5 minutes. Season with salt and pepper.

  4. 4

    Stir in shallots and garlic, cooking until fragrant, about 1 minute. Pour wine to deglaze; simmer 2 minutes.

  5. 5

    Add cream and thyme sprigs, simmer 2 minutes until sauce thickens slightly. Stir in parmesan until melted.

  6. 6

    Add cooked pasta to the skillet; toss gently, adding pasta water if needed for a silky finish. Serve hot.

Tools you’ll need

  • large pot (for pasta)
  • large skillet or sauté pan (12-inch)
  • wooden spoon
  • measuring cups and spoons
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.