CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Clay Pot Rice with Crispy Edges

Vietnamese comfort in one skillet: cooked rice gets layered with savory toppings, soy sauce, and a knob of butter, then crisped hard until the bottom shatters. Serve with a cracked egg on top and a drizzle of fish sauce—pure TikTok gold.

Total time
18 min
Servings
2
Calories
385
Protein
9g
20-Min Clay Pot Rice with Crispy Edges
comfortsatisfyingvietnameseeggscrispytenderweeknightrice

Ingredients

  • 2 cups cooked jasmine rice (room temperature)
  • 2 whole eggs
  • 2 tbsp soy sauce
  • 1 tbsp butter
  • 2 whole scallions, white and light green parts sliced
  • ½ tsp fish sauce

Instructions

  1. 1

    Heat a 10-inch nonstick or cast iron skillet over medium-high until a drop of water sizzles immediately.

  2. 2

    Add butter, then press the rice into the skillet in a single even layer, breaking up clumps with a spatula.

  3. 3

    Drizzle soy sauce over the rice, sprinkle scallions on top, and don't stir—let it sit and crisp, 5-6 minutes.

  4. 4

    Push rice aside to make two small wells, crack an egg into each, cover with a lid or foil, and cook until whites set, 3-4 minutes.

  5. 5

    Drizzle fish sauce over the eggs and rice, then slide onto a plate and serve immediately.

Tools you’ll need

  • 10-inch nonstick or cast iron skillet
  • spatula
  • lid or foil cover

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →