CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Mixed Fried Rice with Chili Oil

Vietnamese-style fried rice loaded with shrimp, chicken, and egg, topped with crispy fried noodles and a hit of chili oil. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
620
Protein
38g
Crispy Mixed Fried Rice with Chili Oil
satisfyingquickvietnameseshrimpchickeneggscrispyfluffy

Ingredients

  • 3 cups cooked jasmine rice (day-old, chilled)
  • ½ lb shrimp, peeled and deveined
  • ½ lb chicken breast, diced small
  • 2 whole eggs
  • 3 cloves garlic, minced
  • 3 tbsp soy sauce
  • 2 tbsp chili oil with garlic
  • 1 cup crispy fried noodles (chow mein or wonton strips)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over high heat until smoking, about 90 seconds.

  2. 2

    Add diced chicken and cook, stirring, until no pink remains, about 4 minutes.

  3. 3

    Push chicken to the side. Add shrimp to the empty space and cook until pink, stirring occasionally, about 3 minutes.

  4. 4

    Add minced garlic and cook, stirring constantly, for 30 seconds until fragrant.

  5. 5

    Crack eggs into the skillet, scramble quickly, breaking yolks, until just cooked through, about 2 minutes.

  6. 6

    Add chilled rice and soy sauce. Stir constantly, breaking up clumps, for 3 minutes until rice is hot and coated.

  7. 7

    Drizzle chili oil over the top and fold in gently. Transfer to a plate.

  8. 8

    Top with crispy fried noodles and serve immediately while rice is still steaming.

Tools you’ll need

  • large skillet or wok (12+ inches)
  • wooden spoon or spatula
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.