Back to recipes
Classic Tapioca Bubble Tea
Chewy tapioca pearls, sweet milk tea, and ice in one iconic Taiwanese drink. Mix, chill, sip—ready in under 10 minutes.
- Total time
- 8 min
- Servings
- 1
- Calories
- 238
- Protein
- 4g

refreshingcasualtaiwanesevegetarianchewycreamysnacksummer
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pour cooled tea into a tall glass. Add condensed milk and stir until fully dissolved and color turns caramel.
Step 2
Pour in whole milk and stir gently to combine. The drink should look pale brown and creamy.
Step 3
Add ice cubes to fill the glass about three-quarters full. Stir briefly to chill.
Step 4
Spoon cooked tapioca pearls into the glass, then drop in the boba straw and serve immediately.
Tools you’ll need
- tall glass (12–16 oz)
- boba straw (wide, for tapioca pearls)
- spoon for stirring and scooping
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



