5-Minute Boba Tea
Chewy tapioca pearls, sweet milk tea, and ice in a glass — the viral TikTok favorite you can make at home in minutes. No special equipment needed, just tea, milk, and a straw.
- Total time
- 5 min
- Servings
- 1
- Calories
- 185
- Protein
- 2g

refreshingcasualtaiwanesevegetarianchewycreamysnacksummer
Ingredients
- ¾ cup brewed black tea, cooled
- ¼ cup whole milk or condensed milk
- ¼ cup cooked tapioca pearls
- 1 tbsp granulated sugar
- ½ cup ice cubes
Instructions
- 1
Pour cooled tea into a tall glass. Stir in sugar until dissolved.
- 2
Add tapioca pearls to the bottom of the glass, then pour in milk.
- 3
Fill the glass with ice and stir gently to combine.
- 4
Insert a wide boba straw and serve immediately.
Tools you’ll need
- tall drinking glass (12-16 oz)
- wide boba straw
- spoon or straw for stirring
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



