Homemade Bubble Tea with Tapioca Pearls
Classic Taiwanese bubble tea made fresh in under 10 minutes—sweet black tea layered with chewy tapioca pearls and ice. No blender, no fancy equipment needed.
- Total time
- 8 min
- Servings
- 2
- Calories
- 185
- Protein
- 1g
refreshingcasualtaiwanesevegetarianvegandairy-freechewysmooth
Ingredients
- 2 bags black tea bags
- 1 cup hot water
- ½ cup tapioca pearls (cooked)
- 3 tbsp brown sugar or honey
- 1 cup ice cubes
- ½ cup whole milk or almond milk
Instructions
- 1
Brew 2 tea bags in 1 cup hot water for 3 minutes, then remove bags.
- 2
Stir in brown sugar until dissolved, then let tea cool for 2 minutes.
- 3
Pour cooked tapioca pearls into the bottom of two tall glasses.
- 4
Fill glasses halfway with ice, then pour cooled tea over the ice.
- 5
Top each glass with 0.25 cup milk, stir well, and serve with a wide boba straw.
Tools you’ll need
- kettle or heat-safe vessel
- spoon
- two tall glasses
- wide bubble tea straw
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
