Churro French Toast with Berries
Thick bread soaked in cinnamon-sugar egg batter, pan-fried until golden and crispy. Serve warm with fresh berries for a breakfast that tastes like dessert.
- Total time
- 15 min
- Servings
- 2
- Calories
- 310
- Protein
- 10g
indulgentcomfortamericanvegetarianeggscrispyfluffyweeknight
Ingredients
- 4 slices bread (thick-cut like brioche or challah), sliced 3/4-inch thick
- 2 whole egg
- 2 tbsp sugar
- 1 tsp cinnamon
- 1 cup mixed berries (strawberries, blueberries, raspberries, blackberries)
Instructions
- 1
Whisk eggs with sugar and cinnamon in a shallow bowl until combined.
- 2
Heat oil in a skillet over medium-high until it shimmers, about 90 seconds.
- 3
Dip bread slices into the egg mixture, coating both sides until saturated.
- 4
Fry bread 2–3 minutes per side until edges are golden brown and crispy.
- 5
Transfer to a plate and top with fresh berries.
Tools you’ll need
- shallow bowl
- whisk
- 12-inch skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
