CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chholar Dal with Fried Mantou

Bengali chickpea curry with creamy coconut and ginger, served warm with crispy fried buns. A comfort-food classic that feels fancy but takes just 20 minutes.

Total time
20 min
Servings
2
Calories
312
Protein
11g
Chholar Dal with Fried Mantou
comfortcozyindianvegetarianchickpeascreamytenderweeknight

Ingredients

  • 1.5 cans (15 oz each) canned chickpeas, drained
  • ¾ cup coconut milk
  • 1 tbsp ginger, minced
  • 1 whole green chili, minced (or 1/2 tsp red chili flakes)
  • 6 pieces store-bought mantou buns (frozen)
  • 2 tbsp vegetable oil (for frying mantou)

Instructions

  1. 1

    Heat 1 tbsp oil in a skillet over medium-high. Fry mantou buns 90 seconds per side until golden and crispy; set aside.

  2. 2

    In the same skillet, add remaining oil. Stir in ginger and chili for 30 seconds until fragrant.

  3. 3

    Add chickpeas and coconut milk; stir to combine. Simmer 8–10 minutes until the sauce thickens slightly.

  4. 4

    Season with salt and pepper to taste. The curry should be creamy and golden.

  5. 5

    Spoon chholar dal into bowls. Serve warm with crispy mantou buns on the side for dipping.

Tools you’ll need

  • large skillet
  • wooden spoon
  • bowl for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.