Custrd is out on the App Store — Download it free →
Back to recipes

25-Min Creamy Veggie Korma

Tender mixed vegetables in a silky coconut-yogurt sauce spiked with curry spices. Ready in 20 minutes, served over steamed rice for a weeknight Indian dinner that tastes like you simmered it for hours.

Total time
25 min
Servings
4
Calories
245
Protein
7g
25-Min Creamy Veggie Korma
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium heat. Add diced onion and cook until soft and translucent, about 4 minutes.

  2. Step 2

    Stir in ginger-garlic paste and tomato paste until fragrant, about 60 seconds.

  3. Step 3

    Add curry powder and stir constantly for 30 seconds to bloom the spices.

  4. Step 4

    Pour in coconut milk and stir well. Add frozen vegetables and bring to a gentle simmer.

  5. Step 5

    Simmer uncovered until vegetables are tender, about 8 minutes. Stir in yogurt off the heat.

  6. Step 6

    Taste and adjust salt and pepper. Serve over steamed rice.

Tools you’ll need

  • large skillet (10–12 inch)
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.