CookSnap is coming soon — Join the waitlist →

25-Min Creamy Veggie Korma

Tender mixed vegetables in a silky coconut-yogurt sauce spiked with curry spices. Ready in 20 minutes, served over steamed rice for a weeknight Indian dinner that tastes like you simmered it for hours.

Total time
25 min
Servings
4
Calories
245
Protein
7g
25-Min Creamy Veggie Korma
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 can (13.5 oz) coconut milk (full-fat canned)
  • ½ cup plain yogurt
  • 3 cups mixed vegetables (frozen peas, carrots, cauliflower, green beans)
  • 1 medium onion, diced
  • 2 tbsp tomato paste
  • 1 tbsp ginger-garlic paste
  • 2 tsp curry powder (or garam masala + turmeric)
  • 2 cups cooked steamed white rice

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium heat. Add diced onion and cook until soft and translucent, about 4 minutes.

  2. 2

    Stir in ginger-garlic paste and tomato paste until fragrant, about 60 seconds.

  3. 3

    Add curry powder and stir constantly for 30 seconds to bloom the spices.

  4. 4

    Pour in coconut milk and stir well. Add frozen vegetables and bring to a gentle simmer.

  5. 5

    Simmer uncovered until vegetables are tender, about 8 minutes. Stir in yogurt off the heat.

  6. 6

    Taste and adjust salt and pepper. Serve over steamed rice.

Tools you’ll need

  • large skillet (10–12 inch)
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.