CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Kashmiri Dum Aloo with Roti

Tender baby potatoes in a silky tomato-yogurt curry spiked with Kashmiri chili and ginger. Served with warm roti for scooping up every last drop of that rich red gravy.

Total time
20 min
Servings
2
Calories
320
Protein
8g
20-Min Kashmiri Dum Aloo with Roti
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

  • 1 lb baby potatoes
  • ½ cup plain yogurt
  • ¾ cup canned crushed tomatoes
  • 1.5 tsp Kashmiri chili powder
  • 1 tbsp ginger, grated
  • 4 pieces roti or naan

Instructions

  1. 1

    Boil potatoes in salted water until just tender, 8–10 minutes. Drain well.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium. Add ginger and cook 30 seconds until fragrant.

  3. 3

    Stir in Kashmiri chili powder, then add yogurt and tomatoes. Mix until smooth.

  4. 4

    Add cooked potatoes and a pinch of salt. Simmer 5 minutes, stirring gently, until sauce coats the potatoes.

  5. 5

    Warm roti in a dry pan or directly over a low flame, 20 seconds per side.

  6. 6

    Serve curry hot alongside warm roti.

Tools you’ll need

  • large saucepan (for boiling potatoes)
  • large skillet (for curry)
  • wooden spoon
  • dry skillet or tongs (for warming roti)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Indian recipes →