Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Kashmiri Dum Aloo with Roti

Tender baby potatoes in a silky tomato-yogurt curry spiked with Kashmiri chili and ginger. Served with warm roti for scooping up every last drop of that rich red gravy.

Total time
20 min
Servings
2
Calories
320
Protein
8g
20-Min Kashmiri Dum Aloo with Roti
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until just tender, 8–10 minutes. Drain well.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium. Add ginger and cook 30 seconds until fragrant.

  3. Step 3

    Stir in Kashmiri chili powder, then add yogurt and tomatoes. Mix until smooth.

  4. Step 4

    Add cooked potatoes and a pinch of salt. Simmer 5 minutes, stirring gently, until sauce coats the potatoes.

  5. Step 5

    Warm roti in a dry pan or directly over a low flame, 20 seconds per side.

  6. Step 6

    Serve curry hot alongside warm roti.

Tools you’ll need

  • large saucepan (for boiling potatoes)
  • large skillet (for curry)
  • wooden spoon
  • dry skillet or tongs (for warming roti)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.