CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Chholar Dal with Coconut

Silky split chickpea dal infused with coconut milk, ginger, and warm spices. A Bengali comfort classic ready in 20 minutes on the stovetop.

Total time
20 min
Servings
4
Calories
280
Protein
12g
20-Min Chholar Dal with Coconut
comfortcozyindianvegetarianveganchickpeascreamysmooth

Ingredients

  • 1 cup split chickpeas (chana dal), rinsed
  • ¾ cup coconut milk (canned, full-fat)
  • 1.5 tbsp ginger, minced
  • 1 whole green chili, minced (or 0.25 tsp red pepper flakes)
  • ½ tsp turmeric powder
  • ½ tsp mustard seeds

Instructions

  1. 1

    Heat 2 tbsp oil in a medium pot over medium. Add mustard seeds; once they pop (30 seconds), add ginger and green chili.

  2. 2

    Stir in the rinsed dal and turmeric. Toast for 1 minute until fragrant, stirring constantly.

  3. 3

    Pour in coconut milk and 1.5 cups water. Bring to a boil, then reduce heat to medium-low and simmer uncovered for 12-15 minutes.

  4. 4

    Stir occasionally. Dal is ready when split chickpeas are completely soft and creamy, breaking apart when pressed.

  5. 5

    Taste and season with salt and a pinch more turmeric if desired. Add water if too thick.

  6. 6

    Serve hot in bowls, drizzled with a touch of oil and a pinch of red pepper flakes if desired.

Tools you’ll need

  • medium saucepan with lid
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.