20-Min Cheesy Ham & Potato Skillet
Diced ham and potatoes get crispy in a skillet, then tossed with melted cheddar and sour cream for a creamy, rich one-pan dinner that tastes way better than it should. Ready in 20 minutes.
- Total time
- 20 min
- Servings
- 4
- Calories
- 520
- Protein
- 32g
comfortheartyamericanporkcreamycrispyweeknightmain-dish
Ingredients
- 1.5 lbs potatoes, diced into 1/2-inch cubes
- 1 lb ham, diced
- 1.5 cups cheddar cheese, shredded
- ¾ cup sour cream
Instructions
- 1
Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering.
- 2
Add diced potatoes and cook, stirring occasionally, until golden and tender, ~12 minutes.
- 3
Stir in ham and cook 2 minutes until edges warm through.
- 4
Remove from heat and fold in cheddar and sour cream until melted and creamy.
- 5
Season with salt and pepper to taste, then serve hot.
Tools you’ll need
- 12-inch skillet or larger
- wooden spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
