CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Cheesy Ham & Potato Skillet

Diced ham and potatoes get crispy in a skillet, then tossed with melted cheddar and sour cream for a creamy, rich one-pan dinner that tastes way better than it should. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
520
Protein
32g
20-Min Cheesy Ham & Potato Skillet
comfortheartyamericanporkcreamycrispyweeknightmain-dish

Ingredients

  • 1.5 lbs potatoes, diced into 1/2-inch cubes
  • 1 lb ham, diced
  • 1.5 cups cheddar cheese, shredded
  • ¾ cup sour cream

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering.

  2. 2

    Add diced potatoes and cook, stirring occasionally, until golden and tender, ~12 minutes.

  3. 3

    Stir in ham and cook 2 minutes until edges warm through.

  4. 4

    Remove from heat and fold in cheddar and sour cream until melted and creamy.

  5. 5

    Season with salt and pepper to taste, then serve hot.

Tools you’ll need

  • 12-inch skillet or larger
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.