Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Charred Fish Bun Cha Ca

Crispy pan-seared white fish over vermicelli noodles with a bright dill-forward Vietnamese sauce. Quick, fragrant, and tastes like you spent hours at the stove.

Total time
20 min
Servings
2
Calories
385
Protein
32g
20-Min Charred Fish Bun Cha Ca
freshlightvietnamesefishcrispytenderweeknightbowl

Ingredients

  • ¾ lb white fish fillets (cod, halibut, or sea bass)
  • 4 oz vermicelli rice noodles
  • 1 cup fresh dill (loosely packed)
  • 1 whole lime
  • 3 tbsp fish sauce
  • 1.5 tbsp granulated sugar

Instructions

  1. 1

    Boil vermicelli in salted water until tender, about 5 minutes. Drain and set aside.

  2. 2

    Whisk fish sauce, sugar, and juice of half the lime with 3 tbsp water. Taste and adjust balance of salty/sour/sweet.

  3. 3

    Pat fish fillets very dry with paper towels. Season both sides generously with salt and black pepper.

  4. 4

    Heat 2 tbsp oil in a skillet over medium-high until it shimmers. Lay fish in pan without moving—sear 3 minutes until edges turn golden.

  5. 5

    Flip fish once. Cook 2 minutes more until opaque throughout and skin crisps. Transfer to plate.

  6. 6

    Divide noodles and dill between bowls. Top with flaked fish, drizzle sauce, squeeze remaining lime juice. Serve immediately.

Tools you’ll need

  • medium pot
  • 12-inch skillet or larger
  • small bowl or cup
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.