CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Bun Cha Ca — Vietnamese Fish Cake Noodle Soup

Tangy, brothy bowl of rice noodles topped with crispy fish cakes and fresh herbs. A TikTok-easy take on the Hanoi classic—no long simmering, just bright flavors in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
18g
20-Min Bun Cha Ca — Vietnamese Fish Cake Noodle Soup
freshlightquickvietnamesefishcrispytenderchewy

Ingredients

  • 10 oz canned fish cakes (cha ca), drained
  • 6 oz rice vermicelli noodles
  • 4 cups water
  • 2 tbsp fish sauce
  • 1 whole lime
  • 1 cup fresh herbs (mint, cilantro, dill), roughly chopped
  • 1 tbsp Vietnamese chili paste or sambal

Instructions

  1. 1

    Bring water to a boil in a large pot over high heat, ~4 minutes.

  2. 2

    While water heats, cut fish cakes into bite-size pieces. Pat with a paper towel to remove excess moisture.

  3. 3

    Add rice noodles to boiling water, stir gently, and cook until tender, ~4 minutes. Drain and divide between two bowls.

  4. 4

    Heat oil in a skillet over medium-high. Pan-fry fish cakes until edges are golden and crispy, ~5 minutes, stirring occasionally.

  5. 5

    Stir fish sauce into the hot cooking water and pour over noodles. Top with crispy fish cakes and fresh herbs.

  6. 6

    Squeeze lime wedge over each bowl. Serve chili paste on the side for stirring in.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon
  • tongs or slotted spoon
  • two serving bowls
  • paper towels
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →