CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Bun Cha Ca — Fish Cake Noodle Soup

Fragrant turmeric broth spiked with dill, loaded with fish cakes and rice noodles, finished with crispy fried shallots and fresh herbs. A weeknight Vietnamese classic that tastes like it simmered all day.

Total time
25 min
Servings
2
Calories
340
Protein
22g
25-Min Bun Cha Ca — Fish Cake Noodle Soup
comfortfreshvietnamesefishtenderchewycrispyweeknight

Ingredients

  • 8 oz fish cakes (Vietnamese or store-bought)
  • 4 oz rice vermicelli noodles
  • 4 cups chicken or seafood broth
  • 1 tsp turmeric powder
  • ½ cup fresh dill
  • 3 tbsp fried shallots
  • 1 cup fresh herbs (mint, cilantro, Thai basil), chopped

Instructions

  1. 1

    Boil salted water in a pot. Cook rice noodles until tender, ~4 minutes. Drain and divide between two bowls.

  2. 2

    In the same pot, combine broth, turmeric, and dill. Bring to a simmer over medium-high heat.

  3. 3

    Slice fish cakes into rounds. Add to broth and simmer until heated through, ~3 minutes.

  4. 4

    Taste the broth. Add salt and white pepper to taste, squeeze of lime juice if you have it.

  5. 5

    Ladle hot broth and fish cakes over noodles. Top with fried shallots and fresh herbs.

  6. 6

    Serve hot with Vietnamese bread on the side for dunking.

Tools you’ll need

  • large pot
  • colander
  • two serving bowls
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.