CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Cashew Chicken with Glossy Sauce

Tender chicken and roasted cashews coated in a sweet-salty soy glaze with a whisper of ginger. Ready in one skillet, perfect for weeknight dinner.

Total time
18 min
Servings
2
Calories
510
Protein
42g
20-Min Cashew Chicken with Glossy Sauce
satisfyingquickchinesechickentendercrispyweeknightmain-dish

Ingredients

  • 1 lb boneless chicken breast or thigh, cut into 1-inch cubes
  • ¾ cup roasted salted cashews
  • 3 tbsp soy sauce
  • 1.5 tbsp honey
  • 1 tbsp fresh ginger, minced
  • 2 whole scallions, sliced thin

Instructions

  1. 1

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add chicken pieces and cook without stirring for 2 minutes, then stir and brown for 3 more minutes until mostly opaque.

  3. 3

    Stir in ginger and cook for 30 seconds until fragrant.

  4. 4

    Pour soy sauce and honey into the skillet, then stir in cashews and toss until the sauce coats everything and turns glossy, about 2 minutes.

  5. 5

    Scatter scallions over the top and toss once more.

  6. 6

    Serve immediately over rice or noodles if desired.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • chef's knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Chinese recipes →