CookSnap is coming soon — Join the waitlist →

Caribbean Curry Shrimp with Coconut Rice & Plantains

Tender shrimp in a fragrant curry-coconut sauce served over fluffy coconut rice with crispy fried plantains and a kick of chili heat. Complete weeknight dinner in under 30 minutes.

Total time
28 min
Servings
2
Calories
648
Protein
28g
Caribbean Curry Shrimp with Coconut Rice & Plantains
satisfyingfreshcaribbeanshrimptendercrispyweeknightdinner

Ingredients

  • 1 lb medium shrimp, peeled and deveined
  • 1 can coconut milk (13.5 oz can)
  • 2 tbsp curry powder
  • 1 cup white rice
  • 2 whole plantains, peeled and cut into 1/4-inch rounds
  • 1 whole lime (juiced)
  • 3 tbsp hot chili sauce (like habanero or scotch bonnet)
  • 2 stalks scallions, sliced (optional garnish)

Instructions

  1. 1

    Boil rice in salted water per package directions. When rice is done, stir in 1/4 cup coconut milk and cover to keep warm.

  2. 2

    Pat shrimp dry. Heat oil in a large skillet over medium-high until it shimmers, about 60 seconds.

  3. 3

    Add curry powder to the skillet and stir constantly for 30 seconds until fragrant.

  4. 4

    Pour in remaining coconut milk and bring to a simmer. Add shrimp and cook for 3-4 minutes until they curl and turn opaque.

  5. 5

    Squeeze lime juice over shrimp. Stir in chili sauce and cook 1 more minute to combine flavors.

  6. 6

    While shrimp simmers, heat 1/2 inch oil in a separate small skillet over medium-high until it shimmers.

  7. 7

    Fry plantain rounds in batches for 2-3 minutes per side until golden and crispy. Drain on paper towels and salt lightly.

  8. 8

    Serve curry shrimp over coconut rice with crispy plantains alongside. Drizzle with extra chili sauce and top with scallions if desired.

Tools you’ll need

  • large skillet
  • medium pot with lid
  • small skillet or shallow pan
  • wooden spoon
  • paper towels
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.