CookSnap is coming soon — Join the waitlist →

Coconut Curry Shrimp with Rice & Crispy Farofa

Tender shrimp in a fragrant coconut-curry sauce, served over fluffy white rice and topped with crispy toasted farofa. One skillet, 25 minutes, and a bottle of hot sauce on the side.

Total time
25 min
Servings
2
Calories
485
Protein
32g
Coconut Curry Shrimp with Rice & Crispy Farofa
comfortsatisfyingcaribbeanshrimptendercreamycrispyweeknight

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 1 can (13.5 oz) coconut milk (full-fat)
  • 2 tbsp curry powder
  • 1.5 cups cooked white rice
  • ½ cup farofa (toasted cassava flour mix)
  • 1 whole lime (zested and juiced)
  • ½ medium onion, diced
  • 2 tbsp hot sauce (habanero or scotch bonnet style)

Instructions

  1. 1

    Cook rice separately according to package instructions. Toast farofa in a dry skillet over medium heat for 2 minutes until fragrant, then transfer to a bowl.

  2. 2

    Heat oil in the skillet over medium-high. Add diced onion and cook until softened and translucent, about 3 minutes.

  3. 3

    Stir in curry powder and cook for 30 seconds until fragrant, then pour in coconut milk and hot sauce.

  4. 4

    Add shrimp and simmer for 4–5 minutes, stirring occasionally, until shrimp are pink and cooked through.

  5. 5

    Remove from heat. Squeeze lime juice over the shrimp and stir in lime zest.

  6. 6

    Divide rice between bowls, top with curry shrimp, and sprinkle crispy farofa over the top. Serve with extra hot sauce on the side.

Tools you’ll need

  • 12-inch skillet
  • small dry skillet (for toasting)
  • wooden spoon
  • measuring spoons
  • cutting board and knife
  • lime juicer (or fork)
  • microplane zester (or box grater)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.