CookSnap is coming soon — Join the waitlist →

20-Min Curry Shrimp with Green Rice

Tender shrimp in a vibrant Caribbean curry sauce, served over garlicky green rice with crispy shallots and fresh salad. One skillet, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
28g
20-Min Curry Shrimp with Green Rice
freshsatisfyingcaribbeanshrimptendercreamyweeknightmain-dish

Ingredients

  • 1 lb large shrimp, peeled and deveined
  • ¾ cup coconut milk
  • 2 tbsp curry powder
  • 2 cup cooked white rice
  • 1 cup fresh spinach or parsley, chopped
  • ¼ cup fried shallots or crispy onions
  • 1 whole lime (juiced and wedges for serving)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  2. 2

    Add shrimp and cook, stirring often, until edges turn pink, about 4 minutes. Transfer to a plate.

  3. 3

    Add curry powder to the same skillet, stir for 30 seconds until fragrant, then pour in coconut milk.

  4. 4

    Return shrimp to the skillet, reduce heat to medium, and simmer 2 minutes until cooked through.

  5. 5

    Stir rice with chopped spinach and a squeeze of lime juice, then divide between plates.

  6. 6

    Ladle curry shrimp over rice, top with fried shallots, and serve with lime wedges and fresh salad.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • wooden spoon or silicone spatula
  • cutting board and knife
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.