CookSnap is coming soon — Join the waitlist →

20-Min Curry Shrimp with Coconut Rice

Tender shrimp simmered in a fragrant Caribbean curry sauce with coconut milk, served over steamed white rice with a fresh microgreens garnish. Bold, aromatic, and completely doable on a weeknight.

Total time
18 min
Servings
2
Calories
485
Protein
32g
20-Min Curry Shrimp with Coconut Rice
satisfyingfreshcaribbeanshrimptendercreamyweeknightdinner

Ingredients

  • 1 lb large shrimp, peeled and deveined
  • ½ medium onion, diced
  • 2 tbsp curry powder (Caribbean or Jamaican blend)
  • 1 can (13.5 oz) coconut milk
  • 1 cup white rice, uncooked
  • ½ cup fresh microgreens or cilantro, for garnish

Instructions

  1. 1

    Bring 2 cups salted water to a boil in a large skillet; add rice, cover, and reduce heat to low for 15 minutes.

  2. 2

    While rice cooks, heat 2 tbsp oil in a separate large skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Add diced onion and sauté for 2 minutes until softened and fragrant.

  4. 4

    Stir in curry powder and cook for 30 seconds until toasted and fragrant.

  5. 5

    Pour in coconut milk, add shrimp, and simmer for 4–5 minutes until shrimp turn pink and opaque throughout.

  6. 6

    Season curry with salt and pepper to taste. Serve shrimp curry over rice and garnish with microgreens.

Tools you’ll need

  • large skillet with lid (for rice)
  • large skillet or sauté pan (for curry)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.