CookSnap is coming soon — Join the waitlist →
Back to recipes

Goan Beef Curry

Fast, aromatic beef curry built on coconut milk and Goan spice paste — no long braise needed. Tender beef, bold coconut, and a whisper of heat in under 25 minutes.

Total time
25 min
Servings
4
Calories
420
Protein
38g
Goan Beef Curry
comfortsatisfyingindianbeeftendercreamyweeknightdinner

Ingredients

  • 1.5 lb beef chuck or sirloin, cut into 1-inch cubes
  • 1 can (13.5 oz) coconut milk (full-fat)
  • 3 tbsp Goan curry paste or red curry paste
  • 1 medium onion, sliced
  • 1 tbsp tomato paste
  • 1 whole lime (juiced)
  • ¼ cup cilantro or parsley, chopped (optional garnish)

Instructions

  1. 1

    Heat oil in a large skillet over medium-high. Add onion, cook until softened and edges brown, ~4 minutes.

  2. 2

    Push onion to the side. Add curry paste, stir for 30 seconds until fragrant, then add beef cubes.

  3. 3

    Sear beef 2–3 minutes without stirring until edges brown. Stir, then cook another 2 minutes.

  4. 4

    Add tomato paste, stir for 1 minute, then pour in coconut milk. Bring to a simmer.

  5. 5

    Simmer uncovered 8–10 minutes until beef is tender and sauce thickens slightly.

  6. 6

    Squeeze lime juice over the top. Taste and adjust salt. Serve over rice with cilantro.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • knife and cutting board
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.