CookSnap is coming soon — Join the waitlist →

15-Min Cardamom Cinnamon Rolls

Scandinavian-style sweet rolls with a fragrant cardamom-cinnamon swirl, baked golden and finished with a quick glaze. Ready in 15 minutes using store-bought puff pastry.

Total time
15 min
Servings
4
Calories
285
Protein
3g
15-Min Cardamom Cinnamon Rolls
cozycomfortscandinavianvegetarianflakytenderweeknightcomfort-food-night

Ingredients

  • 1 sheet (9x10 inches) frozen puff pastry, thawed
  • 2 tbsp butter, softened
  • 1.5 tsp cinnamon
  • 6 pods (or 0.5 tsp ground) cardamom pods, crushed and seeds ground
  • 3 tbsp granulated sugar
  • ½ cup powdered sugar (for glaze)

Instructions

  1. 1

    Preheat oven to 400°F. Mix cinnamon, ground cardamom, and granulated sugar in a small bowl.

  2. 2

    Lay thawed puff pastry flat on a sheet pan. Spread softened butter evenly across the surface.

  3. 3

    Sprinkle the cinnamon-cardamom-sugar mixture evenly over the buttered pastry.

  4. 4

    Tightly roll the pastry from the long edge into a log, then slice into 8 equal pieces.

  5. 5

    Arrange roll pieces cut-side up on the same sheet pan. Bake until edges are golden, 10–12 minutes.

  6. 6

    While rolls bake, whisk powdered sugar with 1 tbsp water until smooth. Drizzle over warm rolls.

Tools you’ll need

  • sheet pan
  • small mixing bowl
  • spoon
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.