CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Caramel Fish with Crispy Shallots

Vietnamese-inspired caramelized seafood in a glossy, salty-sweet sauce finished with crispy fried shallots. One skillet, zero fuss.

Total time
15 min
Servings
2
Calories
285
Protein
28g
Caramel Fish with Crispy Shallots
quickcasualvietnamesefishcrispytenderglossyweeknight

Ingredients

  • 12 oz fish fillets (catfish, tilapia, or cod), cut into 2-inch chunks
  • 3 tbsp granulated sugar
  • 2 tbsp soy sauce
  • 2 medium shallots, sliced thin
  • ¼ cup water
  • 2 tbsp neutral cooking oil for frying shallots

Instructions

  1. 1

    Heat 1 tbsp oil in a 10-inch skillet over medium-high. Once shimmering, add sliced shallots and fry until golden brown and crispy, ~3 minutes. Transfer to a paper towel to cool.

  2. 2

    Add remaining 1 tbsp oil to the skillet. Lay fish chunks in a single layer without crowding; sear 2 minutes per side until golden, working in batches if needed.

  3. 3

    Push fish to the side. Sprinkle sugar directly into the empty pan and stir with a spoon until it melts and turns light amber, ~90 seconds.

  4. 4

    Pour soy sauce and water into the pan, stirring gently to coat the fish. Simmer 2 minutes until the sauce thickens and coats the fish with a gloss.

  5. 5

    Transfer fish and sauce to a serving plate. Top with crispy shallots and serve immediately with jasmine rice.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.