CookSnap is coming soon — Join the waitlist →
Back to recipes

Cantonese Shrimp Toast

Crispy fried bread topped with a savory shrimp paste—a dim sum classic. Pan-fried until golden, these handheld bites deliver umami depth and textural contrast in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
12g
Cantonese Shrimp Toast
casualsimplechineseshrimpcrispytenderweeknightparty

Ingredients

  • ½ lb medium shrimp, peeled and deveined
  • 1 large egg white
  • 1 tbsp cornstarch
  • 1 tbsp soy sauce
  • ½ tsp sesame oil
  • 8 slices white bread, crusts removed
  • ½ cup neutral oil for frying
  • 1 pinch salt and white pepper to taste

Instructions

  1. 1

    Pat the shrimp dry with paper towels and place them on a cutting board.

  2. 2

    Chop the shrimp into small pieces about the size of peas, then transfer to a small bowl.

  3. 3

    Add the egg white, cornstarch, soy sauce, sesame oil, salt, and white pepper to the shrimp and stir until the mixture looks evenly combined and slightly sticky.

  4. 4

    Lay each bread slice flat on a cutting board and spread 1 tablespoon of shrimp paste in an even layer across the entire surface, leaving no gaps.

  5. 5

    Pour the neutral oil into a 10-inch skillet and heat over medium-high heat until it shimmers and a bread cube sizzles immediately when dropped in, about 2 minutes.

  6. 6

    Working in batches of 3–4 slices, carefully place each bread slice shrimp-side down into the hot oil using a spatula or tongs.

  7. 7

    Fry for 2–3 minutes until the shrimp paste turns light tan and the bread underneath becomes golden brown, watching for sizzle.

  8. 8

    Using a slotted spatula, flip each toast carefully and fry the bread side for another 1–2 minutes until it turns the color of warm honey.

  9. 9

    Transfer the finished toast to a paper towel-lined plate to drain excess oil, then repeat with remaining bread slices.

  10. 10

    Arrange the warm shrimp toast on a serving plate with the shrimp side facing up, and serve immediately while crispy.

Tools you’ll need

  • cutting board
  • paper towels
  • small bowl
  • wooden spoon
  • 10-inch skillet
  • instant-read thermometer or wooden chopstick for oil test
  • spatula or slotted turner
  • tongs
  • paper towel-lined plate
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.