CookSnap is coming soon — Join the waitlist →
Back to recipes

California Tri-Tip Sandwich

Seared tri-tip beef with crispy edges, topped with fresh lettuce, tomato, and creamy avocado on toasted bread. A West Coast classic that's ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
620
Protein
42g
California Tri-Tip Sandwich
casualsatisfyingcalifornianbeefcrispytendercreamyweeknight

Ingredients

  • ¾ lb tri-tip beef steak
  • 2 slices sandwich bread (sourdough or ciabatta), sliced
  • 1 whole avocado, ripe
  • 1 medium tomato
  • 1 tablespoon butter
  • 3 leaves lettuce leaves (romaine or butter lettuce)

Instructions

  1. 1

    Remove the tri-tip from the refrigerator and place it on the cutting board. Pat it dry on both sides and top with a generous pinch of salt and pepper so the meat browns evenly.

  2. 2

    Slice the tomato crosswise into 1/4-inch-thick rounds, cutting straight down through the widest part of the fruit.

  3. 3

    Cut the avocado in half lengthwise by rotating it gently as you slice around the pit, then twist the halves apart and lift out the pit with a spoon.

  4. 4

    Scoop the avocado flesh into a small bowl and mash it with a fork until it reaches your preferred texture—chunky or smooth—then season lightly with salt and pepper.

  5. 5

    Heat a 10-inch or 12-inch skillet over medium-high heat until it is very hot, about 2 minutes, then add the tri-tip and sear it without moving it for 4 minutes until a deep brown crust forms on the bottom.

  6. 6

    Flip the tri-tip and sear the other side for 3 to 4 minutes until the surface is golden brown and a meat thermometer inserted into the thickest part reads 130°F for medium-rare.

  7. 7

    Remove the tri-tip to a clean cutting board and let it rest for 3 minutes so the juices stay inside when you slice it, then slice it against the grain into 1/4-inch-thick strips.

  8. 8

    Spread 1 tablespoon of butter on the skillet over medium heat, then place both bread slices flat in the butter and toast them for 2 minutes until the surface turns light golden brown.

  9. 9

    Place one toasted bread slice on a cutting board and spread the mashed avocado evenly across the surface, covering it completely.

  10. 10

    Layer 3 lettuce leaves on top of the avocado, then arrange tomato slices on top of the lettuce in a single layer.

  11. 11

    Pile the tri-tip beef slices on top of the tomato in a slight mound in the center of the sandwich.

  12. 12

    Place the second toasted bread slice on top of the beef, press down gently, then cut the sandwich in half diagonally and serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • fork
  • small bowl
  • 12-inch skillet
  • meat thermometer
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.