CookSnap is coming soon — Join the waitlist →
Back to recipes

California Rolls at Home

Crispy, creamy California rolls with imitation crab, avocado, and cucumber—no raw fish required. A fun, achievable dinner that beats takeout.

Total time
45 min
Servings
2
Calories
320
Protein
8g
California Rolls at Home
casualfunjapanesecrispycreamytenderweeknightdate-night

Ingredients

  • 1.5 cups (cooked) sushi rice
  • 1.5 tbsp rice vinegar
  • 1 tsp sugar
  • 2 sheets nori (seaweed sheets)
  • 6 oz imitation crab stick
  • 1 medium avocado
  • ½ medium cucumber
  • 3 tbsp soy sauce
  • 1 tsp wasabi

Instructions

  1. 1

    Cook sushi rice according to package directions. Spread on a plate to cool, ~5 minutes.

  2. 2

    Whisk rice vinegar and sugar together until sugar dissolves.

  3. 3

    Fold vinegar mixture into cooled rice until evenly coated. Let cool to room temperature.

  4. 4

    Cut crab stick into thin matchsticks about 3 inches long.

  5. 5

    Slice avocado in half, remove the pit, and cut into thin lengthwise slices.

  6. 6

    Cut cucumber in half lengthwise, then slice into thin matchsticks about 3 inches long.

  7. 7

    Place one nori sheet shiny-side down on a bamboo mat. Wet your fingertips with water.

  8. 8

    Spread about 3/4 cup rice evenly across the nori, leaving a 1/2-inch border at the top.

  9. 9

    Lay crab, avocado, and cucumber in a tight line across the center third of the rice.

  10. 10

    Roll tightly from the bottom, using the mat to guide. Seal the edge with water.

  11. 11

    Repeat with the second nori sheet and remaining fillings.

  12. 12

    Slice each roll into 8 pieces using a sharp, wet knife with a gentle sawing motion.

  13. 13

    Mix soy sauce and wasabi in a small bowl.

  14. 14

    Serve rolls with soy-wasabi dipping sauce immediately.

Tools you’ll need

  • pot with lid
  • plate
  • small bowl
  • bamboo sushi mat
  • sharp knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.