CookSnap is in beta — Get it free on TestFlight →
Back to recipes

California Roll at Home

Crispy-outside, creamy-inside sushi rolls made with imitation crab, avocado, and cucumber—no special equipment needed. Perfect for a fun dinner or entertaining.

Total time
25 min
Servings
2
Calories
310
Protein
8g
California Roll at Home
freshcasualjapanesecrispycreamyweeknightdate-nightsushi

Ingredients

  • 1.5 cups sushi rice
  • 2 tbsp rice vinegar
  • 2 sheets nori (seaweed sheets)
  • 4 oz imitation crab stick, flaked
  • ½ whole avocado, peeled
  • ¼ whole cucumber
  • 3 tbsp soy sauce (for serving)

Instructions

  1. 1

    Combine warm cooked sushi rice and rice vinegar in a bowl. Stir gently to coat.

  2. 2

    Slice avocado and cucumber into thin lengthwise strips.

  3. 3

    Place one nori sheet shiny-side down on a bamboo mat. Spread half the rice in a thin layer, leaving a 0.5-inch border at the top.

  4. 4

    Arrange half the crab, avocado, and cucumber in a horizontal line across the center of the rice.

  5. 5

    Roll tightly away from you, using the mat to guide it. Seal the edge with a dab of water.

  6. 6

    Repeat with remaining nori sheet and fillings. Slice each roll into 6-8 pieces with a sharp, wet knife.

  7. 7

    Serve with soy sauce on the side.

Tools you’ll need

  • bowl
  • bamboo sushi mat
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.