CookSnap is coming soon — Join the waitlist →
Back to recipes

Simple Sushi Platter

A fresh, no-cook sushi spread featuring seasoned rice, raw salmon, cucumber, and avocado arranged on a board. Perfect for a quick Japanese-inspired meal or light dinner.

Total time
25 min
Servings
2
Calories
380
Protein
28g
Simple Sushi Platter
lightfreshjapanesefishtendercreamycrispweeknight

Ingredients

  • 2 cups sushi rice, cooked and cooled
  • 2 tablespoons rice vinegar
  • 8 ounces salmon, sushi-grade
  • 1 whole cucumber
  • 1 whole avocado, ripe
  • 3 tablespoons soy sauce

Instructions

  1. 1

    Pour 2 tablespoons of rice vinegar over the 2 cups of cooled sushi rice in a large bowl and stir gently with a wooden spoon until the vinegar is evenly distributed and the rice looks slightly glossy, about 1 minute.

  2. 2

    Pat the 8 ounces of salmon dry with a clean paper towel, then place it on a cutting board and slice it into 1/4-inch-thick rectangles by cutting straight down through the width of the fillet.

  3. 3

    Place the cucumber on a cutting board and slice it lengthwise into thin 1/8-inch-thick sticks by laying it on its side and slicing along its length, like cutting a carrot into matchsticks.

  4. 4

    Cut the avocado in half lengthwise around the pit, twist the halves apart, remove the pit with a spoon, then scoop the flesh out of each half with a spoon and slice it into 1/4-inch-thick slices.

  5. 5

    Spread the seasoned rice across a large wooden or ceramic board or serving platter in a 1/2-inch-thick even layer, creating a rectangular bed about 10 by 6 inches.

  6. 6

    Arrange the salmon slices in a single layer covering the left third of the rice, slightly overlapping each slice.

  7. 7

    Arrange the cucumber sticks in a neat bundle in the center third of the rice, standing them upright or laying them parallel to one another.

  8. 8

    Arrange the avocado slices in the right third of the rice, overlapping them slightly to cover the area.

  9. 9

    Pour 3 tablespoons of soy sauce into a small shallow bowl and place it at one corner of the board for dipping.

Tools you’ll need

  • large bowl
  • wooden spoon
  • cutting board
  • chef's knife
  • paper towels
  • spoon
  • large wooden or ceramic serving board
  • small shallow bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.