California Cobb Wrap
Rotisserie chicken, bacon, avocado, and blue cheese in a crispy tortilla with a side salad—the Cobb reimagined as a handheld wrap that tastes like lunch at a California bistro.
- Total time
- 10 min
- Servings
- 2
- Calories
- 520
- Protein
- 38g
casualfreshcalifornianchickencrispycreamytenderweeknight
Ingredients
- 1.5 cups rotisserie chicken, shredded
- 4 slices bacon, cooked and crumbled
- 1 whole avocado, sliced
- ¼ cup blue cheese, crumbled
- 2 whole flour tortillas (10-inch)
- 1 cup cherry tomatoes, halved
Instructions
- 1
Warm tortillas in a dry skillet over medium heat, 30 seconds per side, until pliable.
- 2
Divide shredded chicken, bacon, avocado, and blue cheese between the two tortillas.
- 3
Roll each tortilla tightly, tucking in the sides, and wrap in foil or parchment if taking to go.
- 4
Toss cherry tomatoes with a splash of olive oil, salt, and pepper for the side salad.
- 5
Serve wraps with the tomato salad alongside.
Tools you’ll need
- 12-inch skillet
- cutting board
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
