CookSnap is coming soon — Join the waitlist →
Back to recipes

Cajun Crawfish Bread

Crusty bread topped with spicy crawfish, butter, and Cajun spices, then broiled until golden. A one-pan showstopper ready in 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Cajun Crawfish Bread
indulgentcasualcajuncrawfishcrispytendermeltyweeknight

Ingredients

  • ¾ lb crawfish tail meat, thawed if frozen
  • 4 tbsp butter
  • 2 tsp Cajun seasoning (paprika, garlic powder, cayenne, thyme)
  • 1 loaf (8 oz) baguette or French bread
  • 2 cloves garlic, minced
  • 3 stalks scallions, thinly sliced

Instructions

  1. 1

    Set the oven to broil on high and move the rack to 6 inches below the heating element so the bread will broil evenly without charring too fast.

  2. 2

    Slice the baguette lengthwise down the middle so you have two long halves, like cutting bread for a hero sandwich, then place them cut-side up on a baking sheet.

  3. 3

    Pat the crawfish tail meat dry using paper towels so it will cook evenly and absorb the Cajun spices better.

  4. 4

    In a small skillet, melt 4 tablespoons of butter over medium heat for about 60 seconds until foaming, then add the minced garlic and cook for 30 seconds until fragrant.

  5. 5

    Add the crawfish tail meat and 2 teaspoons of Cajun seasoning to the skillet, stir gently with a wooden spoon for 2 minutes until the crawfish is heated through and coated with the seasoning.

  6. 6

    Spoon the crawfish mixture evenly onto both bread halves, spreading it from the top to the bottom in a single layer.

  7. 7

    Slide the baking sheet under the broiler and broil for 3 to 4 minutes until the surface turns the color of warm honey and the edges just begin to look darker.

  8. 8

    Remove the bread from the oven using oven mitts, then scatter the sliced scallions over the top and serve immediately while still hot.

Tools you’ll need

  • chef's knife
  • cutting board
  • baking sheet
  • 8-inch skillet
  • wooden spoon
  • paper towels
  • oven mitts

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.