CookSnap is coming soon — Join the waitlist →
Back to recipes

Burrata Cloud Toast with Avocado

Whipped burrata creates a pillowy cloud on crispy sourdough, topped with creamy avocado, bright citrus, and crispy breadcrumbs. A stunning 15-minute meal that looks restaurant-worthy.

Total time
15 min
Servings
2
Calories
512
Protein
14g
Burrata Cloud Toast with Avocado
elegantlightitalianvegetariancheesecreamycrispyfluffy

Ingredients

  • 8 oz burrata cheese
  • 2 thick slices sourdough bread
  • 1 whole ripe avocado
  • ½ whole lemon
  • 3 tbsp panko breadcrumbs
  • 3 tbsp olive oil
  • 1 pinch fleur de sel or sea salt
  • 1 pinch crushed red pepper flakes

Instructions

  1. 1

    Cut burrata into chunks and place in a bowl. Drizzle with 1 tbsp olive oil and let soften 3 minutes.

  2. 2

    Scoop avocado flesh into a separate bowl. Squeeze lemon juice over it and mash roughly with a fork.

  3. 3

    Heat 1 tbsp olive oil in a skillet over medium-high until shimmering, about 1 minute.

  4. 4

    Toast breadcrumbs in the skillet, stirring constantly, until golden and fragrant, 2-3 minutes. Transfer to a plate.

  5. 5

    Add remaining 1 tbsp oil to the skillet. Lay sourdough slices flat and cook until edges crisp and surface turns golden, 2 minutes per side.

  6. 6

    Whip softened burrata with a fork until it reaches a soft, cloud-like consistency, about 1 minute.

  7. 7

    Spread whipped burrata generously over each toast slice while still warm from the skillet.

  8. 8

    Top with mashed avocado, keeping it rustic and peaked. Sprinkle toasted breadcrumbs, sea salt, and red pepper flakes over the top.

  9. 9

    Serve immediately while toast is still warm and burrata is pillowy.

Tools you’ll need

  • 2 small mixing bowls
  • fork
  • 12-inch skillet
  • wooden spoon or spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.