CookSnap is coming soon — Join the waitlist →

Burrata Caprese Toast

Creamy burrata, juicy heirloom tomatoes, and fresh basil on crispy toast — no cooking required, just assembly. Ready in 5 minutes.

Total time
5 min
Servings
2
Calories
285
Protein
9g
Burrata Caprese Toast
lightsimplecalifornianvegetariancheesecreamycrispysnack

Ingredients

  • 2 slices bread (sourdough or ciabatta)
  • 4 oz burrata cheese
  • 2 medium heirloom tomatoes
  • 6 leaves fresh basil leaves
  • 1 tbsp olive oil

Instructions

  1. 1

    Toast the bread until edges are golden and centers still give slightly when pressed, about 2 minutes.

  2. 2

    Slice the heirloom tomatoes into 1/4-inch rounds.

  3. 3

    Tear the burrata into chunks and distribute evenly between the two toasts.

  4. 4

    Layer the tomato slices on top of the burrata, then scatter the basil leaves across.

  5. 5

    Drizzle with olive oil and season with salt and black pepper to taste. Serve immediately.

Tools you’ll need

  • toaster or toaster oven
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.