Burrata Caprese Toast
Creamy burrata, juicy heirloom tomatoes, and fresh basil on crispy toast — no cooking required, just assembly. Ready in 5 minutes.
- Total time
- 5 min
- Servings
- 2
- Calories
- 285
- Protein
- 9g

lightsimplecalifornianvegetariancheesecreamycrispysnack
Ingredients
- 2 slices bread (sourdough or ciabatta)
- 4 oz burrata cheese
- 2 medium heirloom tomatoes
- 6 leaves fresh basil leaves
- 1 tbsp olive oil
Instructions
- 1
Toast the bread until edges are golden and centers still give slightly when pressed, about 2 minutes.
- 2
Slice the heirloom tomatoes into 1/4-inch rounds.
- 3
Tear the burrata into chunks and distribute evenly between the two toasts.
- 4
Layer the tomato slices on top of the burrata, then scatter the basil leaves across.
- 5
Drizzle with olive oil and season with salt and black pepper to taste. Serve immediately.
Tools you’ll need
- toaster or toaster oven
- cutting board
- sharp knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



