CookSnap is coming soon — Join the waitlist →
Back to recipes

Biltong & Charred Vegetable Salad

Crispy sliced biltong tops a warm salad of charred peppers and red onion with a bright lemon-olive oil dressing. A quick, protein-packed South African–inspired meal that comes together in under 20 minutes.

Total time
18 min
Servings
2
Calories
412
Protein
28g
Biltong & Charred Vegetable Salad
freshlightsouth-africanbeefcrispytendercharredweeknight

Ingredients

  • 4 oz biltong, thinly sliced
  • 1 large red bell pepper, halved and seeded
  • ½ medium red onion, cut into thick wedges
  • 3 cups mixed salad greens or arugula
  • 4 tbsp olive oil
  • 2 tbsp lemon juice
  • 1 pinch salt and black pepper
  • 2 tbsp fresh cilantro or parsley, chopped (optional)

Instructions

  1. 1

    Whisk together lemon juice, 3 tbsp olive oil, salt, and pepper in a small bowl.

  2. 2

    Cut bell pepper into 1-inch chunks. Separate onion wedges into individual layers.

  3. 3

    Heat 1 tbsp olive oil in a large skillet over medium-high until it shimmers.

  4. 4

    Add pepper and onion. Sear without stirring for 3 minutes until edges char and blacken.

  5. 5

    Stir and cook 2 more minutes until peppers are soft with charred spots.

  6. 6

    Place greens in a large bowl. Pour warm vegetables and any pan juices over them.

  7. 7

    Drizzle dressing over the salad and toss gently to coat.

  8. 8

    Divide between plates. Top each with crispy biltong slices and cilantro if desired.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch skillet
  • cutting board
  • chef's knife
  • large serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.